LYL1 Polyclonal antibody

• 

  IP experiment of K-562 using 15946-1-AP

  IP result of anti-LYL1 (IP:15946-1-AP, 4ug; Detection:15946-1-AP 1:500) with K-562 cells lysate 1800 ug.

LYL1 Polyclonal Antibody for IP, ELISA

Cat No. 15946-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

Protein lyl-1, Lymphoblastic leukemia-derived sequence 1, Class A basic helix-loop-helix protein 18, bHLHa18

---

Tested Applications

• Positive IP detected in: K-562 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15946-1-AP targets LYL1 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8528

  Product name: Recombinant human LYL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-280 aa of BC002796

  Sequence: MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

• Full Name: lymphoblastic leukemia derived sequence 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC002796
• Gene Symbol: LYL1
• Gene ID (NCBI): 4066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12980
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphoblastic leukemia1 (LYL1) is a proto-oncogenic transcription factor found upregulated in patients with T-cell acute lymphoblastic leukemia (T-cell ALL). LYL1 has an important role in hematopoietic stem cell biology, normal hematopoiesis and leukemia. It is expressed throughout the hematopoietic lineages with the exception of T-cells. LYL1 shows two bands in the WB detection, where the upper band is the phosphorylated form and the lower band is the non-phosphorylated form (PMID: 10023675, PMID: 20844761).