LYPLAL1 Polyclonal antibody

• 

  WB analysis using 16146-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16146-1-AP (LYPLAL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16146-1-AP

  WB result of LYPLAL1 antibody (16146-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LYPLAL1 transfected HeLa cells.

• 

  IHC staining of human liver cancer using 16146-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16146-1-AP (LYPLAL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16146-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16146-1-AP (LYPLAL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16146-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16146-1-AP (LYPLAL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16146-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16146-1-AP (LYPLAL1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 16146-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16146-1-AP (LYPLAL1 Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

LYPLAL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16146-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:3.1.2.22, KIAA1238, lysophospholipase like 1, Lysophospholipase-like protein 1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells
• Positive IHC detected in: human liver cancer tissue, mouse kidney tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

16146-1-AP targets LYPLAL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9271

  Product name: Recombinant human LYPLAL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC016711

  Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

• Full Name: lysophospholipase-like 1
• Calculated Molecular Weight: 237 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC016711
• Gene Symbol: LYPLAL1
• Gene ID (NCBI): 127018
• RRID: AB_2138521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWZ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lysophospholipase-like 1 protein, encoded by LYPLAL1, a 26 kDa cytosol protein which belongs to a subclass of lysophospholipase family. Human genome-wide association studies link variants of the gene encoding this enzyme to fat distribution, waist-to-hip ratio and non-alcoholic fatty liver disease. LYPLAL1 reported to be up-regulated in subcutaneous adipose tissue of obese individuals.(PMID: 25958046, PMID: 27391855, PMID: 21674055)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Discovery of small-molecule enzyme activators by activity-based protein profiling.; Authors - Bernard P Kok
mouse	WB	Dis Model Mech; Lyplal1 is dispensable for normal fat deposition in mice.; Authors - Rachel A Watson ; KO Validated
mouse,human	WB,IHC	Mol Cell; Targeting LYPLAL1-mediated cGAS depalmitoylation enhances the response to anti-tumor immunotherapy; Authors - Yizeng Fan
mouse	WB	J Mol Endocrinol; Knockout of murine Lyplal1 confers sex-specific protection against diet-induced obesity; Authors - Rishel B Vohnoutka

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Bernard (Verified Customer) (11-11-2019)

Works perfectly for overexpressed protein and endogenous protein in 293T cells

• Applications: Western Blot,
• Cell Tissue Type: 293T