LYVE1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LYVE1 Polyclonal antibody (34236-1-AP)

• 

  WB analysis using 34236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34236-1-AP (LYVE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 34236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 34236-1-AP (LyVE-1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 34236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 34236-1-AP (LyVE-1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 34236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 34236-1-AP (LYVE1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 34236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 34236-1-AP (LYVE1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat liver using 34236-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using LYVE1 antibody (34236-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LYVE1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 34236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Cell surface retention sequence-binding protein 1, Lymphatic vessel endothelial hyaluronic acid receptor 1, LYVE-1, Crsbp1, CRSBP-1

---

Tested Applications

• Positive WB detected in: bEnd.3 cells, mouse lung tissue
• Positive IHC detected in: mouse liver tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34236-1-AP targets LYVE1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6367

  Product name: Recombinant mouse LyVE-1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-234 aa of NM_053247.4

  Sequence: ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGFGGVPT

• Full Name: lymphatic vessel endothelial hyaluronan receptor 1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 55 kDa, 60-70 kDa
• GenBank Accession Number: NM_053247.4
• Gene Symbol: Lyve1
• Gene ID (NCBI): 114332
• RRID: AB_3743178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8BHC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.