Use Able AI chat for product recommendations

LYVE1 Polyclonal antibody

LYVE1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Cell surface retention sequence-binding protein 1, CRSBP 1, CRSBP1, CRSBP-1, Extracellular link domain-containing protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LYVE1 in ?

Tested Applications

Positive WB detected inHUVEC cells, bEnd.3 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue
Positive IHC detected inrat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28321-1-AP targets LYVE1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28131

Product name: Recombinant human LYVE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 192-322 aa of BC026231

Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

Predict reactive species
Full Name lymphatic vessel endothelial hyaluronan receptor 1
Calculated Molecular Weight 322 aa, 35 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC026231
Gene Symbol LYVE1
Gene ID (NCBI) 10894
RRIDAB_3086043
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y5Y7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Protocols

Product Specific Protocols
IF protocol for LYVE1 antibody 28321-1-APDownload protocol
IHC protocol for LYVE1 antibody 28321-1-APDownload protocol
WB protocol for LYVE1 antibody 28321-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

LYVE1 Polyclonal antibody (Cat# 28321-1-AP) has accumulated 11 citations across journals including Nature Communications, Journal of Advanced Research, Aging Cell, Frontiers in Immunology, International Immunopharmacology, Cell Signaling, Experimental Eye Research, Discovery Oncology, Neuroscience Letters, Surgical and Radiological Anatomy, and Frontiers in Physiology. Associated research fields span lymphatic biology, oncology, neurology and stroke, immunology, ophthalmology, and stem cell biology.

SpeciesApplicationTitle
IHC

Nat Commun

Lymph nodes molecular subtypes unravel lymph nodes heterogeneity and clinical implications in colorectal cancer

Authors - Xu Guan
mouseWB

J Adv Res

Aquaporin 4 and its isoforms regulation ameliorate AQP4 Mis-localization-induced glymphatic dysfunction in ischemic stroke

Authors - Hanhong Zhang

Aging Cell

Senescent Macrophages Promote Age-Related Revascularization Impairment by Increasing Antiangiogenic VEGF-A165B Expression

Authors - Minghong Chen
mouseIF

Front Immunol

Meningeal lymphatic vessel dysfunction exacerbates brain injury in CVST mice via endoplasmic reticulum and oxidative stress pathways.

Authors - Jianbin Ying
mouseWB,IF

Int Immunopharmacol

Targeting IL-1β to inhibit neutrophil extracellular traps improves meningeal lymphatic dysfunction in cerebral venous sinus thrombosis.

Authors - Jun Li

Cell Signal

Effect of the BMP4-Smad pathway on corneal immune double-arm and mechanism study.

Authors - Yuxiao Guo
Loading...
||
New chat

Able™

正在加载,请稍候...