LYZL1 Polyclonal antibody

• 

  WB analysis of mouse testis using 17207-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17207-1-AP (LYZL1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17207-1-AP (LYZL1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17207-1-AP (LYZL1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human spleen using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 17207-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17207-1-AP (LYZL1 antibody) at dilution of 1:50 (under 40x lens).

LYZL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17207-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Lysozyme-like protein 1, Lysozyme like protein 1, lysozyme like 1, LYC2, KAAG648

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue, human lung tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:100-1:500
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17207-1-AP targets LYZL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10986

  Product name: Recombinant human LYZL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC021730

  Sequence: MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS

• Full Name: lysozyme-like 1
• Calculated Molecular Weight: 194 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC021730
• Gene Symbol: LYZL1
• Gene ID (NCBI): 84569
• RRID: AB_2138916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UWQ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYZL1(Lysozyme-like 1) is also named as LYC2 and belongs to the glycosyl hydrolase 22 family. It is involved in the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. LYZL1 has two isoforms with the molecular weight of 17 kDa and 22 kDa. The full length protein has a signal peptide of 19 amino acids and a glycosylation site. This antibody detects the N-terminal of LYZL1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Proteomics Clin Appl; Proteomic Analysis of Dpy19l2-Deficient Human Globozoospermia Reveals Multiple Molecular Defects.; Authors - Yueshuai Guo