• Featured Product
  • KD/KO Validated

HRP-conjugated Lamin B1 Recombinant monoclonal antibody

Lamin B1 Uni-rAb® Recombinant Antibody for WB

Cat No. HRP-80906
Clone No.5H10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB

LMNB1, LMNB, LMN2, Lamin-B1, laminB1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

HRP-80906 targets Lamin B1 in WB applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3631

Product name: Recombinant human Lamin B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 237-587 aa of BC012295

Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Predict reactive species
Full Name lamin B1
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66-70 kDa
GenBank Accession NumberBC012295
Gene Symbol Lamin B1
Gene ID (NCBI) 4001
ENSEMBL Gene IDENSG00000113368
RRIDAB_3673984
Conjugate HRP
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20700
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Expression of uncleavable mutant lamin A or B caused significant delays in the onset of chromatin condensation and nuclear shrinkage during apoptosis (PMID:11953316). This protein is not suitable for samples where the nuclear envelope has been removed.

Protocols

Product Specific Protocols
WB protocol for HRP Lamin B1 antibody HRP-80906Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...