Tested Applications
| Positive WB detected in | rat adipose tissue, human adipose tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83655-3-RR targets Leptin in WB, IHC, ELISA applications and shows reactivity with rat samples.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0892 Product name: Recombinant Rat Leptin protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 22-167 aa of NM_013076.3 Sequence: VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC Predict reactive species |
| Full Name | leptin |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 15-16 kDa |
| GenBank Accession Number | NM_013076.3 |
| Gene Symbol | Leptin |
| Gene ID (NCBI) | 25608 |
| RRID | AB_3671263 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P50596 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leptin is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. Leptin is the most critical hormone in the homeostatic regulation of energy balance among those so far discovered. Leptin primarily acts on the neurons of the mediobasal part of hypothalamus to regulate food intake, thermogenesis, and the blood glucose level. Leptin also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. Leptin has also been linked to type 2 diabetes mellitus development.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Leptin antibody 83655-3-RR | Download protocol |
| WB protocol for Leptin antibody 83655-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









