CoraLite® Plus 488-conjugated Lipocalin-2/NGAL Polyclonal antibody

• 

  IF Staining of RAW 264.7 using CL488-26991

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CoraLite® Plus 488 Lipocalin-2/NGAL antibody (CL488-26991) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Lipocalin-2/NGAL Polyclonal Antibody for IF/ICC

Cat No. CL488-26991

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

---

Tested Applications

• Positive IF/ICC detected in: RAW 264.7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26991 targets Lipocalin-2/NGAL in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25715

  Product name: Recombinant human LCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-198 aa of

  Sequence: MQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Full Name: lipocalin 2
• Observed Molecular Weight: 25 kDa
• Gene Symbol: NGAL/LCN2
• Gene ID (NCBI): 3934
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80188
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Neutrophil gelatinase-associated lipocalin (NGAL, also known as human neutrophil lipocalin, lipocalin-2, siderocalin, or LCN2) is a small molecule of almost 25 kDa that belongs to the well-defined superfamily of proteins called lipocalins. NGAL initially found in activated neutrophils, in accordance with its role as an innate antibacterial factor. However, it subsequently was shown that many other types of cells, including in the kidney tubule, may produce NGAL in response to various injuries. NGAL may become one of the most promising next-generation biomarkers in clinical nephrology and beyond.