Lumican Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Lumican Polyclonal antibody, PBS Only (10677-1-PBS)

• 

  WB analysis of Jurkat using 10677-1-AP (same clone as 10677-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10677-1-AP (Lumican antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10677-1-AP (same clone as 10677-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10677-1-AP (Lumican antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10677-1-AP (same clone as 10677-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10677-1-AP (Lumican antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10677-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 10677-1-AP (same clone as 10677-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Lumican antibody (10677-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10677-1-PBS in a different storage buffer formulation.

Lumican Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 10677-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

LUM, SLRR2D, LDC, KSPG lumican

---

Product Information

10677-1-PBS targets Lumican in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1106

  Product name: Recombinant human LUM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC007038

  Sequence: MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

• Full Name: lumican
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 50-90 kDa
• GenBank Accession Number: BC007038
• Gene Symbol: Lumican
• Gene ID (NCBI): 4060
• RRID: AB_2139481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lumican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843)