Lumican Recombinant monoclonal antibody, PBS Only

Lumican Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85343-1-PBS
Clone No.242615H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

LUM, 242615H3, KSPG lumican, LDC, SLRR2D

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85343-1-PBS targets Lumican in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2923

Product name: Recombinant Human Lumican protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 19-338 aa of NM_002345.3

Sequence: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Predict reactive species
Full Name lumican
Calculated Molecular Weight38 kDa
Observed Molecular Weight50-90 kDa
GenBank Accession NumberNM_002345.3
Gene Symbol Lumican
Gene ID (NCBI) 4060
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51884
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Lumican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843)

Loading...
||
New chat Able
正在加载,请稍候...