Lumican Recombinant monoclonal antibody

Lumican Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85343-1-RR
Clone No.242615H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

LUM, 242615H3, KSPG lumican, LDC, SLRR2D

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, Recombinant protein, HEK-293 cells, Y79 cells, MCF-7 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85343-1-RR targets Lumican in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2923

Product name: Recombinant Human Lumican protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 19-338 aa of NM_002345.3

Sequence: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Predict reactive species
Full Name lumican
Calculated Molecular Weight38 kDa
Observed Molecular Weight50-90 kDa
GenBank Accession NumberNM_002345.3
Gene Symbol Lumican
Gene ID (NCBI) 4060
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51884
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lumican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843)

Protocols

Product Specific Protocols
IHC protocol for Lumican antibody 85343-1-RRDownload protocol
WB protocol for Lumican antibody 85343-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...