Mouse Lumican Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse skin using 86082-3-RR (same clone as 86082-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86082-3-RR (Lum antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86082-3-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 86082-3-RR (same clone as 86082-3-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 86082-3-RR (Lum antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86082-3-PBS in a different storage buffer formulation.

Lumican Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86082-3-PBS

Clone No.250614E5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Keratan sulfate proteoglycan lumican, KSPG lumican, Lcn, Ldc, Lum

---

Product Information

86082-3-PBS targets Lumican in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2481

  Product name: Recombinant Mouse Lumican protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-338 aa of NM_008524.2

  Sequence: QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN

• Full Name: lumican
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 50-100 kDa
• GenBank Accession Number: NM_008524.2
• Gene Symbol: Lum
• Gene ID (NCBI): 17022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51885
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

umican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843)