Product Information
33363-1-PBS targets Luteinizing Hormone beta in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38132 Product name: Recombinant human Luteinizing Hormone beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-141 aa of NM_000894 Sequence: SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL* Predict reactive species |
| Full Name | luteinizing hormone beta polypeptide |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15-18 kDa |
| GenBank Accession Number | NM_000894 |
| Gene Symbol | LHB |
| Gene ID (NCBI) | 3972 |
| RRID | AB_3742950 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P01229 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Luteinizing Hormone beta subunit (LH-β) is a critical glycoprotein hormone chain that confers functional specificity to the intact LH hormone. While it non-covalently associates with the common alpha subunit (shared with other pituitary hormones like FSH and TSH), the unique beta subunit is responsible for dictating receptor binding specificity. The binding of LH to its receptor in the gonads is primarily mediated by the beta subunit, triggering signaling cascades essential for reproductive physiology. In females, this stimulates ovulation and progesterone production, and in males, it drives testosterone synthesis in Leydig cells. Therefore, the expression and structural integrity of the LH-β gene are indispensable for the regulation of steroidogenesis and gametogenesis, making it a cornerstone of the hypothalamic-pituitary-gonadal axis.
