M-cadherin Polyclonal antibody

• 

  WB analysis using 29928-1-AP

  C2C12 cells were subjected to SDS PAGE followed by western blot with 29928-1-AP (M-cadherin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse skeletal muscle using 29928-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using M-cadherin antibody (29928-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

M-cadherin Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 29928-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

CDH15, Cadherin 14, Cadherin 15, Cadherin-14, Cadherin-15

---

Tested Applications

• Positive WB detected in: C2C12 cells
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29928-1-AP targets M-cadherin in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25763

  Product name: Recombinant human CDH15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-450 aa of BC008951

  Sequence: AFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR

• Full Name: cadherin 15, type 1, M-cadherin (myotubule)
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC008951
• Gene Symbol: M-cadherin
• Gene ID (NCBI): 1013
• RRID: AB_3086192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55291
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. M-cadherin (muscle cadherin), also known as CDH15 (cadherin-15), is a 124-kDa type I transmembrane glycoprotein that is highly expressed in developing skeletal muscle, satellite cells, and cerebellum (PMID: 9545347; 12052883). It associates with β-catenin and functions as a cell-cell adhesion molecule in a homophilic and specific manner (PMID: 9545347). M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation (PMID: 1840697).