Tested Applications
| Positive WB detected in | U-87 MG cells, NIH/3T3 cells, mouse lung tissue |
| Positive IHC detected in | human lung tissue, human skeletal muscle tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells, NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13058-1-AP targets MACF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3730 Product name: Recombinant human MACF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-305 aa of BC007330 Sequence: EDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKTSLQFSRCYDKPWLVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR Predict reactive species |
| Full Name | microtubule-actin crosslinking factor 1 |
| Calculated Molecular Weight | 5430 aa, 620 kDa |
| Observed Molecular Weight | 600 kDa |
| GenBank Accession Number | BC007330 |
| Gene Symbol | MACF1 |
| Gene ID (NCBI) | 23499 |
| RRID | AB_2877907 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MACF1, also called ACF7 (actin crosslinking family 7), is a member of the spectraplakin family and is a ubiquitously expressed 614 kDa protein. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. It displays a conserved role in membrane protrusion formation during evolution. The two major MACF1 isoforms characterized to date, MACF1a and MACF1b, result from alternative splicing. Both proteins contain N-terminal actin-binding domains (ABD), followed by plakin domains, extended spectrin repeat domains, EF-hand motifs, and C-terminal microtubule-binding domains (MTBDs). MACF1 is expressed in numerous tissue, including the skin, brain, skeletal muscle, and heart.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MACF1 antibody 13058-1-AP | Download protocol |
| IHC protocol for MACF1 antibody 13058-1-AP | Download protocol |
| WB protocol for MACF1 antibody 13058-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
MACF1 antibody (Cat# 13058-1-AP) has 12 citations spanning journals including Gastroenterology, Nature Communications, Cell Death & Differentiation, Materials Today Bio, Aging, Oncotarget, European Journal of Medical Research, Biomedical Pharmacotherapy, PLoS Genetics, Journal of Bioenergetics and Biomembranes, Journal of Molecular Histology, and Heliyon. Research fields cover gastrointestinal stromal tumors, cholangiocarcinoma, gastric cancer, colorectal cancer, lung adenocarcinoma, acute myeloid leukemia, osteoblast differentiation, bone scaffolding, photoreceptor biology, and cuproptosis.
| Species | Application | Title |
|---|---|---|
Gastroenterology Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors | ||
Nat Commun The genomic landscape of cholangiocarcinoma reveals the disruption of post-transcriptional modifiers. | ||
Cell Death Differ MACF1 promotes osteoblast differentiation by sequestering repressors in cytoplasm.
| ||
Mater Today Bio 3D printing combined with thermally induced phase separation for engineering hierarchical osteogenic PLA scaffolds. | ||
Aging (Albany NY) Comparison of the mutation patterns between tumor tissue and cell-free DNA in stage IV gastric cancer | ||
Oncotarget LRP6 promotes invasion and metastasis of colorectal cancer through cytoskeleton dynamics. |
Reviews
What customers say
One reviewer (Joleen Cheah) rated this antibody 3 out of 5 stars after using it for Western Blot at a 1:1k dilution on MDCK GII cells. While MACF1 appeared as the top band as expected, she noted the presence of numerous non-specific bands, which somewhat diminished the overall result quality.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (06-03-2019) | MACF1 should be the top band but there were a lot of non specific bands as well.
 |
