MADD Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MADD Polyclonal antibody, PBS Only (29663-1-PBS)

• 

  WB analysis using 29663-1-AP (same clone as 29663-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29663-1-AP (MADD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29663-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29663-1-AP (same clone as 29663-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29663-1-AP (MADD antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29663-1-PBS in a different storage buffer formulation.

MADD Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29663-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MAP kinase-activating death domain protein, KIAA0358, IG20, FLJ36300, FLJ35600

---

Product Information

29663-1-PBS targets MADD in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31292

  Product name: Recombinant human MADD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1395-1544 aa of BC040484

  Sequence: WRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS

• Full Name: MAP-kinase activating death domain
• Calculated Molecular Weight: 1544 aa, 171 kDa
• Observed Molecular Weight: 200-250 kDa
• GenBank Accession Number: BC040484
• Gene Symbol: MADD
• Gene ID (NCBI): 8567
• RRID: AB_3086151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXG6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MADD, MAP kinase-activating death domain protein, belongs to the DENN family, which regulates the Rab family is small GTPases (PMID: 20937701, PMID: 18559336). MADD plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. MADD is also involved in TNFA-mediated activation of the MAPK pathway, including ERK1/2 (PMID: 32761064). KIF1Bβ- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD (PMID: 18849981).