MAGI3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84771-4-RR (same clone as 84771-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84771-4-RR (MAGI3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84771-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84771-4-RR (same clone as 84771-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84771-4-RR (MAGI3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84771-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 84771-4-RR (same clone as 84771-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using MAGI3 antibody (84771-4-RR, Clone: 242212C9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84771-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84771-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84771-4-RR against Human MAGI3 were performed. The affinity constant is 0.752 nM.

MAGI3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84771-4-PBS

Clone No.242212C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

242212C9, KIAA1634, MAGI-3, Membrane-associated guanylate kinase inverted 3, Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3

---

Product Information

84771-4-PBS targets MAGI3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18394

  Product name: Recombinant human MAGI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 496-777 aa of BC130409

  Sequence: LPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID

• Full Name: membrane associated guanylate kinase, WW and PDZ domain containing 3
• Calculated Molecular Weight: 1481 aa, 163 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC130409
• Gene Symbol: MAGI3
• Gene ID (NCBI): 260425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5TCQ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI3.