MAGI3 Recombinant monoclonal antibody, PBS Only

MAGI3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 84771-4-PBS
Clone No.242212C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

242212C9, KIAA1634, MAGI-3, Membrane-associated guanylate kinase inverted 3, Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84771-4-PBS targets MAGI3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18394

Product name: Recombinant human MAGI3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 496-777 aa of BC130409

Sequence: LPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID

Predict reactive species
Full Name membrane associated guanylate kinase, WW and PDZ domain containing 3
Calculated Molecular Weight 1481 aa, 163 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC130409
Gene Symbol MAGI3
Gene ID (NCBI) 260425
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ5TCQ9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI3.

Loading...
||
New chat Able
正在加载,请稍候...