MAGI3 Recombinant monoclonal antibody

MAGI3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 84771-4-RR
Clone No.242212C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

242212C9, KIAA1634, MAGI-3, Membrane-associated guanylate kinase inverted 3, Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84771-4-RR targets MAGI3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18394

Product name: Recombinant human MAGI3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 496-777 aa of BC130409

Sequence: LPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID

Predict reactive species
Full Name membrane associated guanylate kinase, WW and PDZ domain containing 3
Calculated Molecular Weight 1481 aa, 163 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC130409
Gene Symbol MAGI3
Gene ID (NCBI) 260425
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ5TCQ9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI3.

Protocols

Product Specific Protocols
IF protocol for MAGI3 antibody 84771-4-RRDownload protocol
IHC protocol for MAGI3 antibody 84771-4-RRDownload protocol
WB protocol for MAGI3 antibody 84771-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...