Product Information
32867-1-PBS targets MAGOHB in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37296 Product name: Recombinant human MAGOHB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC010905 Sequence: MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSK Predict reactive species |
| Full Name | mago-nashi homolog B (Drosophila) |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC010905 |
| Gene Symbol | MAGOHB |
| Gene ID (NCBI) | 55110 |
| RRID | AB_3742770 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96A72 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Mago Homolog B, Exon Junction Complex Subunit (MAGOHB), is a key component of the exon junction complex (EJC), which is crucial for pre-mRNA splicing, mRNA transport, and nonsense-mediated decay (NMD). It plays a redundant role with MAGOH in the EJC and is required for proper mRNA processing and translation (PMID: 23917022). Additionally, MagoHB is involved in multiple biological processes, including neurogenesis, brain development, cell cycle regulation, and apoptosis (PMID: 37294214).
