MAGT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAGT1 Polyclonal antibody, PBS Only (17430-1-PBS)

• 

  WB analysis using 17430-1-AP (same clone as 17430-1-PBS)

  Mouse cerebellum lysates were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17430-1-AP (same clone as 17430-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 17430-1-AP (same clone as 17430-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 17430-1-AP (same clone as 17430-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17430-1-AP (same clone as 17430-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 17430-1-AP (same clone as 17430-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17430-1-AP (MAGT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 17430-1-AP (MAGT1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 17430-1-AP (MAGT1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 17430-1-AP (MAGT1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 17430-1-AP (MAGT1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17430-1-AP (MAGT1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17430-1-AP (MAGT1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17430-1-AP (same clone as 17430-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17430-1-AP (MAGT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 17430-1-AP (same clone as 17430-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using MAGT1 antibody (17430-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Histone H3 antibody (68345-1-Ig, Clone: 1A2A3, blue). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17430-1-AP (same clone as 17430-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using 17430-1-AP and Rhodamine-labeled goat anti-rabbit IgG (red).Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 17430-1-AP (same clone as 17430-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using MAGT1 antibody (17430-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17430-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAGT1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 17430-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

bA217H1.1, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1, IAG2, IAP, Implantation-associated protein

---

Product Information

17430-1-PBS targets MAGT1 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11496

  Product name: Recombinant human MAGT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-182 aa of BC060842

  Sequence: KKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIR

• Full Name: magnesium transporter 1
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 45-47 kDa
• GenBank Accession Number: BC060842
• Gene Symbol: MAGT1
• Gene ID (NCBI): 84061
• RRID: AB_2138982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0U3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients'cells by western blot or immunofluorescent cell surface staining. MAGT1 had been detected as 38 kDa (PMID: 18705540) or 45-47 kDa (PMID: 27383987) by western blot.