Tested Applications
| Positive WB detected in | mouse brain tissue, NIH/3T3 cells, HuH-7 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27994-1-AP targets MAGT1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27416 Product name: Recombinant human MAGT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 266-335 aa of BC060842 Sequence: VAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS Predict reactive species |
| Full Name | magnesium transporter 1 |
| Calculated Molecular Weight | 335 aa, 38 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC060842 |
| Gene Symbol | MAGT1 |
| Gene ID (NCBI) | 84061 |
| RRID | AB_2881033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0U3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients' cells by western blot or immunofluorescent cell surface staining (Nature 475, 471-6). 27994-1-AP antibody detects the glycosylated protein around 45-50 kDa in SDS-PAGE. (PMID: 28720733, 27383987)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MAGT1 antibody 27994-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





