Tested Applications
| Positive WB detected in | mouse brain tissue, NIH/3T3 cells, HuH-7 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27994-1-AP targets MAGT1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27416 Product name: Recombinant human MAGT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 266-335 aa of BC060842 Sequence: VAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS Predict reactive species |
| Full Name | magnesium transporter 1 |
| Calculated Molecular Weight | 335 aa, 38 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC060842 |
| Gene Symbol | MAGT1 |
| Gene ID (NCBI) | 84061 |
| RRID | AB_2881033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0U3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients' cells by western blot or immunofluorescent cell surface staining (Nature 475, 471-6). 27994-1-AP antibody detects the glycosylated protein around 45-50 kDa in SDS-PAGE. (PMID: 28720733, 27383987)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MAGT1 antibody 27994-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MAGT1 Polyclonal antibody (Cat# 27994-1-AP) has 1 citation. It appears in International Journal of Molecular Medicine (IF 8.5), in a 2022 study investigating how transcription factor KLF16 activates MAGT1 to regulate tumorigenesis and progression of breast cancer. The research field is oncology, specifically breast cancer biology. The antibody was used for Western blot in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Int J Mol Med Transcription factor KLF16 activates MAGT1 to regulate the tumorigenesis and progression of breast cancer. |
