MAK16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAK16 Polyclonal antibody, PBS Only (17505-1-PBS)

• 

  WB analysis using 17505-1-AP (same clone as 17505-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17505-1-AP (MAK16 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17505-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 17505-1-AP (same clone as 17505-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MAK16 antibody (17505-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17505-1-PBS in a different storage buffer formulation.

MAK16 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17505-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

RBM13, Protein RBM13, Protein MAK16 homolog, NNP78

---

Product Information

17505-1-PBS targets MAK16 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11705

  Product name: Recombinant human MAK16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC050528

  Sequence: MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKVIERAAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQEAESDSSDTEEKDDDDDDEEDVGKREFVEDGEVDESDISDFEDMDKLDASSDEDQDGKSSSEEEEEKALSAKHKGKMPLRGPLQRKRAYVEIEYEQETEPVAKAKTT

• Full Name: MAK16 homolog (S. cerevisiae)
• Calculated Molecular Weight: 300 aa, 35 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC050528
• Gene Symbol: MAK16
• Gene ID (NCBI): 84549
• RRID: AB_2281504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXY0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.