MAOA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAOA Polyclonal antibody, PBS Only (10539-1-PBS)

• 

  WB analysis of LNCaP using 10539-1-AP (same clone as 10539-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 10539-1-AP (MAOA antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10539-1-AP (same clone as 10539-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10539-1-AP (MAOA antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10539-1-AP (same clone as 10539-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10539-1-AP (MAOA antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IP experiment of LNCaP using 10539-1-AP (same clone as 10539-1-PBS)

  IP result of anti-MAOA (IP:10539-1-AP, 4ug; Detection:10539-1-AP 1:5000) with LNCaP cells lysate 880 ug. This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10539-1-AP (same clone as 10539-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10539-1-AP (MAOA antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10539-1-AP (same clone as 10539-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10539-1-AP (MAOA antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10539-1-AP (same clone as 10539-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10539-1-AP (MAOA antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10539-1-AP (same clone as 10539-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10539-1-AP (MAOA antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10539-1-AP (same clone as 10539-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10539-1-AP (MAOA antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10539-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAOA Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10539-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Amine oxidase [flavin-containing] A, EC:1.4.3.21, MAO A, MAO-A, monoamine oxidase A

---

Product Information

10539-1-PBS targets MAOA in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0821

  Product name: Recombinant human MAOA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-527 aa of BC008064

  Sequence: HPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS

• Full Name: monoamine oxidase A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008064
• Gene Symbol: MAOA
• Gene ID (NCBI): 4128
• RRID: AB_2137251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21397
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAOA belongs to the flavin monoamine oxidase family. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.