MAOA Monoclonal antibody, PBS Only

• 

  WB analysis using 68471-1-Ig (same clone as 68471-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68471-1-Ig (MAOA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 68471-1-Ig (same clone as 68471-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68471-1-Ig (MAOA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68471-1-Ig (same clone as 68471-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68471-1-Ig (MAOA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68471-1-Ig (same clone as 68471-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68471-1-Ig (MAOA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68471-1-Ig (same clone as 68471-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68471-1-Ig (MAOA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 68471-1-Ig (same clone as 68471-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug MAOA Monoclonal antibody (68471-1-Ig, Clone:1A9E4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 68471-1-PBS in a different storage buffer formulation.

MAOA Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 68471-1-PBS

Clone No.1A9E4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

1A9E4, Amine oxidase [flavin-containing] A, EC:1.4.3.21, MAO A, MAO-A

---

Product Information

68471-1-PBS targets MAOA in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30028

  Product name: Recombinant human MAOA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-527 aa of BC008064

  Sequence: HPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS

• Full Name: monoamine oxidase A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008064
• Gene Symbol: MAOA
• Gene ID (NCBI): 4128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21397
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAOA belongs to the flavin monoamine oxidase family. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.