MAOA Monoclonal antibody

MAOA Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 68471-1-Ig
Clone No.1A9E4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

1A9E4, Amine oxidase [flavin-containing] A, EC:1.4.3.21, MAO A, MAO-A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, U2OS cells, LNCaP cells, Jurkat cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68471-1-Ig targets MAOA in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30028

Product name: Recombinant human MAOA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 242-527 aa of BC008064

Sequence: HPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS

Predict reactive species
Full Name monoamine oxidase A
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC008064
Gene Symbol MAOA
Gene ID (NCBI) 4128
RRIDAB_3085182
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21397
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAOA belongs to the flavin monoamine oxidase family. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Protocols

Product Specific Protocols
FC protocol for MAOA antibody 68471-1-IgDownload protocol
IHC protocol for MAOA antibody 68471-1-IgDownload protocol
WB protocol for MAOA antibody 68471-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...