Tested Applications
| Positive WB detected in | SH-SY5Y cells, rat brain tissue, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | iPS cells |
| Positive FC (Intra) detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 108 publications below |
| IHC | See 44 publications below |
| IF | See 272 publications below |
Product Information
17490-1-AP targets MAP2 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11580 Product name: Recombinant human MAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species |
| Full Name | microtubule-associated protein 2 |
| Calculated Molecular Weight | 200 kDa |
| Observed Molecular Weight | 280 kDa, 70-85 kDa |
| GenBank Accession Number | BC038857 |
| Gene Symbol | MAP2 |
| Gene ID (NCBI) | 4133 |
| RRID | AB_2137880 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11137 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Microtubule-associated protein 2 (MAP2) is a tubulin binding protein regulating the spacing and stability of microtubules and contributing to elongation of dendrites.
What is the molecular weight of MAP2? Is MAP2 post-translationally modified?
MAP2 has multiple isoforms that arise from alternative splicing (PMID: 3121794, 7854050, and 10383434). They are classified into two groups - MAP2A and MAP2B, which are known as high molecular weight (HMW) isoforms, run as ~280 kDa species, while low molecular weight (LMW) isoforms MAP2C and MAP2D are around ~70 kDa. MAP2 proteins are heavily phosphorylated, which contributes to a large discrepancy between their predicted and observed molecular weight in SDS-PAGE (220 vs 280 kDa for HMW forms).
What is the tissue expression pattern of MAP2? What is the subcellular localization of MAP2?
MAP2 isoforms differ in their tissue and developmental expression pattern (PMID: 2469170 and 3898077). In the brain, MAP2B is widely expressed during and post development, MAP2A is expressed postnatally, while MAP2C is present only in the early development except of present in photosensitive cells of the adult retina and in the olfactory system. MAP proteins are highly expressed in the CNS found in cell bodies and dendrites of neurons, in dorsal root ganglion, reactive glia, and in the testis (PMID: 9588626). In neurons, MAP2 proteins are found in the cell body and dendrites, where they associate with microtubules, while they can also be present in the nuclei of testicular cells.
Can MAP2 be used as a neuronal marker?
MAP2 proteins are abundantly expressed in neurons. MAP2 is frequently used as a dendritic marker because it is present in the cell body and dendrites of neurons but absent in axons (PMID: 28413822).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IF protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IHC protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IP protocol for MAP2 antibody 17490-1-AP | Download protocol |
| WB protocol for MAP2 antibody 17490-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell In vivo reprogramming of NG2 glia enables adult neurogenesis and functional recovery following spinal cord injury. | ||
Cell Stem Cell Recent Zika Virus Isolates Induce Premature Differentiation of Neural Progenitors in Human Brain Organoids. | ||
Nat Commun Reliability of high-quantity human brain organoids for modeling microcephaly, glioma invasion and drug screening | ||
Nat Commun Repair-associated macrophages increase after early-phase microglia attenuation to promote ischemic stroke recovery | ||
Neuron Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory. | ||
Sci Adv Glioblastoma exploits ATP from leading-edge astrocytes to fuel its infiltrative growth revealed by spatially resolved chimeric analysis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ahmad (Verified Customer) (04-29-2026) | Good antibody for IF !
|
FH Makenna (Verified Customer) (07-15-2024) | Antibody worked well for IF at a dilution of 1:500
|
FH Abigail (Verified Customer) (07-15-2024) | Used for IF and got clear images in green and red channels.
|
FH Reyes (Verified Customer) (04-05-2024) | MAP2 (in green) shows a strong marking of my neurons in human brain FFPE cortex
![]() |
FH Filipa (Verified Customer) (09-18-2023) | I used this anti-MAP2 antibody at 1:200 dilution for IF. The cells were fixed in 4% PFA in PBS for 20 minutes, and incubated with the primary antibody for 3 hours at RT. MAP2 staining works very well at this dilution.
![]() |
FH BING (Verified Customer) (08-04-2021) | suitable for detection of both bands of MAP2 by WB with one above 250 kd
![]() |
FH Dipen (Verified Customer) (07-20-2020) | Not great for Western blotting.
![]() |
FH Naomi (Verified Customer) (03-09-2020) | I used the rabbit polyclonal anti-MAP2 antibody at 1:500 dilution to in differentiated PC-12 cells. The cells were fixed in 4% PFA in PBS for 12 minutes. 1 hr in blocking buffer, followed by 24 h incubation in primary antibody. MAP2 was expressed in neurites. Works well at this dilution, great images.
|
FH Gloria (Verified Customer) (01-30-2020) | Beautiful staining in primary hippocampal and cortical neurons.
![]() |
FH Ricky (Verified Customer) (02-22-2019) | 1:5000 dilution is good enough for a clear and sharp image of western blot. I am now using Li-Cor's Odyssey CLX imaging systems . The second antibody is from Li-Cor with 1:5000 dilution. By the way, I also tried to use 1:1000 dilution for my low expression samples, and there was no bad noise backgrounds.
|








































