MAP2K3 Monoclonal antibody

• 

  WB analysis using 68574-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68574-1-Ig (MAP2K3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 68574-1-Ig

  WB result of MAP2K3 antibody (68574-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAP2K3 transfected A431 cells.

• Featured Product
• KD/KO Validated

MAP2K3 Monoclonal Antibody for WB, ELISA

Cat No. 68574-1-Ig

Clone No.1H3E10

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MEK3, 1H3E10, Dual specificity mitogen-activated protein kinase kinase 3, EC:2.7.12.2, MAP kinase kinase 3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A431 cells, HepG2 cells, MCF-7 cells, HeLa cells, A549 cells, Jurkat cells, NIH/3T3 cells, C2C12 cells, HSC-T6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68574-1-Ig targets MAP2K3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4861

  Product name: Recombinant human MAP2K3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-347 aa of BC032478

  Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

• Full Name: mitogen-activated protein kinase kinase 3
• Calculated Molecular Weight: 347 aa, 39 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC032478
• Gene Symbol: MAP2K3
• Gene ID (NCBI): 5606
• RRID: AB_3670384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Ethnopharmacol; Luteolin and its analog luteolin-7-methylether from Leonurus japonicus Houtt suppress aromatase-mediated estrogen biosynthesis to alleviate polycystic ovary syndrome by the inhibition of tumor progression locus 2; Authors - Xiao-Ke Shi