MAP2K3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68574-1-Ig (same clone as 68574-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68574-1-Ig (MAP2K3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68574-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 68574-1-Ig (same clone as 68574-1-PBS)

  WB result of MAP2K3 antibody (68574-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAP2K3 transfected A431 cells. This data was developed using the same antibody clone with 68574-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAP2K3 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68574-1-PBS

Clone No.1H3E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

MEK3, 1H3E10, Dual specificity mitogen-activated protein kinase kinase 3, EC:2.7.12.2, MAP kinase kinase 3

---

Product Information

68574-1-PBS targets MAP2K3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4861

  Product name: Recombinant human MAP2K3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-347 aa of BC032478

  Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

• Full Name: mitogen-activated protein kinase kinase 3
• Calculated Molecular Weight: 347 aa, 39 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC032478
• Gene Symbol: MAP2K3
• Gene ID (NCBI): 5606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46734
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.