Tested Applications
| Positive WB detected in | HeLa cells, human kidney tissue |
| Positive IHC detected in | human breast cancer tissue, rat skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12745-1-AP targets MEK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3706 Product name: Recombinant human MAP2K6 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-334 aa of BC012009 Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD Predict reactive species |
| Full Name | mitogen-activated protein kinase kinase 6 |
| Calculated Molecular Weight | 334 aa, 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC012009 |
| Gene Symbol | MEK6 |
| Gene ID (NCBI) | 5608 |
| RRID | AB_2141563 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52564 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAPKK6 (Dual specificity mitogen activated protein kinase kinase 6), also known as MAP2K6 / MEK6 / MKK6, is a member of MAPKK protein kinase family. MKK6 plays an important role in intracellular signaling pathways leading toward activation of the p38 MAP kinase. MEK6 phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. MEK6 plays a complex role in cancer, with some evidence showing it can promote tumor growth. Overexpression of MEK6 has been linked to decreased survival in lung adenocarcinoma, breast cancer, and melanoma.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MEK6 antibody 12745-1-AP | Download protocol |
| IHC protocol for MEK6 antibody 12745-1-AP | Download protocol |
| WB protocol for MEK6 antibody 12745-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody (catalog no. 12745-1-AP) has 11 total citations across journals including Nature Aging, Cell Death & Disease, Acta Pharmacologica Sinica, Cell Reports, Scientific Reports, Food & Function, Cell Cycle, Journal of Cancer, Int J Biol Macromol, and In Vitro Cell Dev Biol Anim. Research fields span aging and bone loss, gastric/ovarian/breast cancer, ferroptosis in tuberculosis, mitophagy, oxidative stress, cell migration, m⁶A modification, and osteoarthritis. Applications are primarily WB and IHC.
| Species | Application | Title |
|---|---|---|
Nat Aging Skin chronological aging drives age-related bone loss via secretion of cystatin-A | ||
Cell Death Dis MAP2K6 reprograms NAD(+) metabolism via the HMGA1-NAMPT axis to sensitize ovarian cancer cells to PARP inhibition. | ||
Acta Pharmacol Sin Targeting PRSS23 with tipranavir induces gastric cancer stem cell apoptosis and inhibits growth of gastric cancer via the MKK3/p38 MAPK-IL24 pathway
| ||
Int J Biol Macromol Mycobacterium tuberculosis Rv2521 promotes ferroptosis-dependent pathogenicity by inhibiting NF-κB activation | ||
Cell Rep MAP2K6 directly phosphorylates BCL2L13 to mediate mitophagy for suppressing tumorigenicity | ||
Food Funct L-Theanine mediates the p38MAPK signaling pathway to alleviate heat-induced oxidative stress and inflammation in mice. |
