Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, C6 cells, C2C12 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11229-1-AP targets MAP4 in WB, IHC, IF, IP, IP-MS, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1741 Product name: Recombinant human MAP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 629-979 aa of BC012794 Sequence: KSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTEGKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI Predict reactive species |
| Full Name | microtubule-associated protein 4 |
| Calculated Molecular Weight | 121 kDa |
| Observed Molecular Weight | 210-240 kDa |
| GenBank Accession Number | BC012794 |
| Gene Symbol | MAP4 |
| Gene ID (NCBI) | 4134 |
| RRID | AB_2140681 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P27816 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAP4 is a ubiquitously expressed microtubule-associated protein involved in the organization and stabilization of microtubules during various cellular activities. Recently it has been reported that expression of MAP4 was upregulated in esophageal squamous cell carcinoma (ESCC). MAP4 has been considered as an independent prognostic factor for ESCC. The predicted molecular weight of MAP4 is about 120 kDa, while higher molecular weight around 200-250 kDa is usually observed in WB test, which may be the result of glycosylation. (26876215, 8647865)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MAP4 antibody 11229-1-AP | Download protocol |
| IP protocol for MAP4 antibody 11229-1-AP | Download protocol |
| WB protocol for MAP4 antibody 11229-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-MAP4 antibody (Cat# 11229-1-AP) has accumulated 31 citations across journals including Molecular Cell, Cell Death & Differentiation, Oncogene, Brain, Cancer Letters, Acta Neuropathologica, and Journal of Experimental & Clinical Cancer Research. Research fields span cancer biology (colorectal, lung, esophageal, bladder, breast), neuroscience (Alzheimer's disease, tau pathology), cardiology, microtubule dynamics, cytoskeletal regulation, epithelial-mesenchymal transition, antiviral immunity, and autophagy. Primary applications include Western blot, immunohistochemistry, immunofluorescence, and immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Circ Res FGF13 Regulates VGSC-Independent Cardiomyocyte Impulse Propagation via Cx43 Trafficking. | ||
Acta Pharm Sin B Reversibly unlocking the blood-brain barrier: A study on microtubule dynamics modulation using gold nanoparticle-modified reduced graphene oxide. | ||
J Exp Clin Cancer Res FBXW7 loss of function promotes esophageal squamous cell carcinoma progression via elevating MAP4 and ERK phosphorylation
| ||
Cell Death Differ LGALS1-CD276 Paracrine axis between tumor and endothelial cells promotes tumor angiogenesis and progression in bladder cancer.
| ||
Brain Interactome screening of C9orf72 dipeptide repeats reveals VCP sequestration and functional impairment by polyGA. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution. One user (4/5) tested it on sheep atrial tissue, noting the signal was a bit faint but bands appeared in expected locations with clear data. The other (5/5) tested it on mouse heart tissue and observed multiple bands, attributing them to different post-translational modifications. Overall, users report acceptable performance with some variability in signal intensity depending on the tissue source.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alice (Verified Customer) (08-09-2022) | Not bad for western blot. A bit faint but had bands in expected places and can see clear data.
 |
CHAO (Verified Customer) (03-31-2022) | Multiple bands may be due to different post-translational modifications
|
