MAP6/STOP Polyclonal antibody

• 

  WB analysis using 25717-1-AP

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 25717-1-AP (MAP6/STOP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25717-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25717-1-AP (MAP6/STOP antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 25717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25717-1-AP (MAP6/STOP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 25717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25717-1-AP (MAP6/STOP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-12 using 25717-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using MAP6/STOP antibody (25717-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MAP6/STOP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25717-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA1878, MAP 6, MAP6, MAP6/STOP, MTAP6, N STOP, Stable tubule only polypeptide, STOP

---

Tested Applications

• Positive WB detected in: mouse retina tissue, mouse brain tissue, mouse cerebellum tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25717-1-AP targets MAP6/STOP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22471

  Product name: Recombinant human MAP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 144-484 aa of BC139780

  Sequence: GQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP

• Full Name: microtubule-associated protein 6
• Calculated Molecular Weight: 813 aa, 87 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC139780
• Gene Symbol: MAP6
• Gene ID (NCBI): 4135
• RRID: AB_3085819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JE9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP6, also named STOP protein, has been isolated from brain preparations but is also present in other tissues such as the skeletal muscles and heart. MAP6 is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Different isoforms of STOP protein arise from alternative mRNA splicing and transcription initiation sites using a single gene. The neuronal MAP6 isoforms N-STOP (120 kDa) and E-STOP (80 kDa), the astrocyte MAP6 isoform A-STOP (60 KDa), and a fibroblastic MAP6 isoform F-STOP (48 kDa) have been identified.