MAP6/STOP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAP6/STOP Polyclonal antibody, PBS Only (25717-1-PBS)

• 

  WB analysis using 25717-1-AP (same clone as 25717-1-PBS)

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 25717-1-AP (MAP6/STOP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25717-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25717-1-AP (same clone as 25717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25717-1-AP (MAP6/STOP antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 25717-1-AP (same clone as 25717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25717-1-AP (MAP6/STOP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 25717-1-AP (same clone as 25717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25717-1-AP (MAP6/STOP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25717-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 25717-1-AP (same clone as 25717-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using MAP6/STOP antibody (25717-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25717-1-PBS in a different storage buffer formulation.

MAP6/STOP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25717-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25717-1-PBS targets MAP6/STOP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22471

  Product name: Recombinant human MAP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 144-484 aa of BC139780

  Sequence: GQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP

• Full Name: microtubule-associated protein 6
• Calculated Molecular Weight: 813 aa, 87 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC139780
• Gene Symbol: MAP6
• Gene ID (NCBI): 4135
• RRID: AB_3085819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JE9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAP6, also named STOP protein, has been isolated from brain preparations but is also present in other tissues such as the skeletal muscles and heart. MAP6 is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Different isoforms of STOP protein arise from alternative mRNA splicing and transcription initiation sites using a single gene. The neuronal MAP6 isoforms N-STOP (120 kDa) and E-STOP (80 kDa), the astrocyte MAP6 isoform A-STOP (60 KDa), and a fibroblastic MAP6 isoform F-STOP (48 kDa) have been identified.