MAP7D3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAP7D3 Polyclonal antibody (27573-1-AP)

• 

  WB analysis using 27573-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27573-1-AP (MAP7D3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

MAP7D3 Polyclonal Antibody for WB, ELISA

Cat No. 27573-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MAP7 domain containing 3, MDP3

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, MDA-MB-468 cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27573-1-AP targets MAP7D3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26082

  Product name: Recombinant human MAP7D3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 301-400 aa of NM_001173516

  Sequence: ASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVSTYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEA

• Full Name: MAP7 domain containing 3
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 125-130 kDa
• GenBank Accession Number: NM_001173516
• Gene Symbol: MAP7D3
• Gene ID (NCBI): 79649
• RRID: AB_3742239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWC1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP7D3, also known as MDP3, features two coiled-coil regions near its N terminus, followed by a linker region, a MAP7-like domain, and a C-terminal domain. MAP7D3 is a microtubule-binding protein that regulates microtubule assembly and stability. MAP7D3 expression is cell cycle dependent, with lower expression in the G2 phase compared to its expression in the other phases of the cell cycle(PMID: 22142902).