MAPK15 Polyclonal antibody

• 

  WB analysis of mouse lung using 13452-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13452-1-AP (MAPK15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse lung using 13452-1-AP

  IP result of anti-MAPK15 (IP:13452-1-AP, 4ug; Detection:13452-1-AP 1:500) with mouse lung tissue lysate 3800ug.

• 

  IHC staining of human kidney using 13452-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13452-1-AP (MAPK15 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 13452-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13452-1-AP (MAPK15 antibody) at dilution of 1:200 (under 40x lens).

MAPK15 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13452-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ERK 7, ERK 8, ERK7, ERK8, MAP kinase 15, MAPK 15, MAPK15

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13452-1-AP targets MAPK15 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4255

  Product name: Recombinant human MAPK15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-274 aa of BC028034

  Sequence: MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQL

• Full Name: mitogen-activated protein kinase 15
• Calculated Molecular Weight: 544 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC028034
• Gene Symbol: MAPK15
• Gene ID (NCBI): 225689
• RRID: AB_2877950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TD08
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Lett; Metastasis-associated gene MAPK15 promotes the migration and invasion of osteosarcoma cells via the c-Jun/MMPs pathway.; Authors - Zexin Su
human		Cell Rep; IMPDH2 dephosphorylation under FGFR signaling promotes S-phase progression and tumor growth; Authors - Bei Zhou