MAPRE2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAPRE2 Polyclonal antibody (10364-1-AP)

• Featured Product
• KD/KO Validated

MAPRE2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10364-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

APC binding protein EB2, APC-binding protein EB2, EB2, End-binding protein 2, Microtubule-associated protein RP/EB family member 2

• 

  WB analysis of K-562 using 10364-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10364-1-AP (MAPRE2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10364-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10364-1-AP (MAPRE2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 10364-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10364-1-AP (MAPRE2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse cells using 10364-1-AP

  Mouse keratinocyte showing MAPRE2 (#10364-1-AP, 1:100 dilution, with Alexa 594 labelled 2nd Ab) in red and alpha-tubulin (#66031-1-lg, 1:100 dilution, with Alexa 488 labelled 2nd Ab ) in green.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HCT 116 using 10364-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HCT 116 cells using MAPRE2 antibody (10364-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAPRE2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, Jurkat cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HCT 116 cells, mouse cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10364-1-AP targets MAPRE2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0416

  Product name: Recombinant human MAPRE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-327 aa of BC007318

  Sequence: QTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY

• Full Name: microtubule-associated protein, RP/EB family, member 2
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 39-42 kDa
• GenBank Accession Number: BC007318
• Gene Symbol: MAPRE2
• Gene ID (NCBI): 10982
• RRID: AB_2141649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15555
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RP1 protein shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family and binds specifically to the C-terminal region of the APC protein. RP1 also binds directly to tubulin, both in vitro and in vivo. The function of RP1 is currently unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. It may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.

Publications

What published studies show

The MAPRE2 Polyclonal antibody (Cat# 10364-1-AP) has 2 total citations. These appear in Science Advances and Experimental Cell Research. The cited studies span neurobiology (mitochondrial ubiquitylation and Parkin targets in primary neurons) and reproductive cell biology (meiotic progression in mouse oocytes). Both citations used the antibody for Western blot applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Sci Adv; Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1.; Authors - Odetta Antico
mouse	WB	Exp Cell Res; MAPRE2 regulates the first meiotic progression in mouse oocytes.; Authors - Yuan-Yuan Li ; KD Validated