Home
Products
Primary Antibodies
MARK4 Polyclonal antibody, PBS Only (20174-1-PBS)

Filter: AllIHC

IHC staining of human kidney using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 20174-1-AP (MARK4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 20174-1-AP (MARK4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 20174-1-AP (same clone as 20174-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon slide using 20174-1-AP (MARK4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 20174-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

MARK4 Polyclonal antibody, PBS Only

Name: MARK4 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20174-1-PBS

MARK4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20174-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20174-1-PBS targets MARK4 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14013 Product name: Recombinant human MARK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 627-751 aa of BC009049 Sequence: VADEPERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDLE Predict reactive species
Full Name	MAP/microtubule affinity-regulating kinase 4
Calculated Molecular Weight	752 aa, 83 kDa
GenBank Accession Number	BC009049
Gene Symbol	MARK4
Gene ID (NCBI)	57787
RRID	AB_2636847
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96L34
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

MARK4(MAP/microtubule affinity-regulating kinase 4) is also named as KIAA1860, MARKL1 and belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. It is directly involved in microtubule organization in neuronal cells and may contribute to the pathological phosphorylation of tau in Alzheimer's disease and it also plays a role in hepatocellular carcinogenesis. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 83 kDa and 75 kDa. MARK4 can exsit as 40-65 kDa forms in hippocampal homogenates from Alzheimer`s disease and non-demented elderly cases besides the full-length isoform 84 kDa. (PMID:24533944).