MARVELD2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 86188-1-RR (same clone as 86188-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86188-1-RR (MARVELD2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86188-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 86188-1-RR (same clone as 86188-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using MARVELD2 antibody (86188-1-RR, Clone: 250774G9 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86188-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86188-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86188-1-RR against Human MARVELD2 were performed. The affinity constant is 1.19 nM.

MARVELD2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86188-1-PBS

Clone No.250774G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

DFNB49, MARVD2, MARVEL domain containing 2, MARVEL domain-containing protein 2, MRVLDC2

---

Product Information

86188-1-PBS targets MARVELD2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4446

  Product name: Recombinant human MARVELD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 365-558 aa of BC033689

  Sequence: LWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS

• Full Name: MARVEL domain containing 2
• Calculated Molecular Weight: 558 aa, 64 kDa
• Observed Molecular Weight: 60-64 kDa
• GenBank Accession Number: BC033689
• Gene Symbol: MARVELD2
• Gene ID (NCBI): 153562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N4S9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MARVELD2, also named as Tricellulin or TRIC, is a 558 amino acid protein, which contains one MARVEL domain. MARVELD2 localizes the cell membrane and plays a role in the formation of the epithelial barriers. MARVELD2, is a first integral membrane protein that is concentrated at the vertically oriented tight junction strands of tricellular contacts. MARVELD2 may be a component to maintain the integrity for peripheral nervous system myelin function and morphology.