Tested Applications
| Positive WB detected in | mouse serum |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86615-3-RR targets MASP1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg4420 Product name: Recombinant Mouse MASP1 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 300-445 aa of NM_008555.2 Sequence: RAAGNECPKLQPPVYGKIEPSQAVYSFKDQVLVSCDTGYKVLKDNEVMDTFQIECLKDGAWSNKIPTCKIVDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTCLPVCGVPK Predict reactive species |
| Full Name | mannan-binding lectin serine peptidase 1 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | NM_008555.2 |
| Gene Symbol | Masp1 |
| Gene ID (NCBI) | 17174 |
| RRID | AB_3745009 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P98064-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MASP1, also known as CRARF, is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The lectin pathway is triggered upon binding of mannan-binding lectin (MBL) and ficolins to sugar moieties, which leads to activation of the associated proteases MASP1 and MASP2. The observed molecular weight of 90 kDa is consistent with the values described in the literature (PMID: 24472859, 12396007).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MASP1 antibody 86615-3-RR | Download protocol |
| WB protocol for MASP1 antibody 86615-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



