MAT2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAT2B Polyclonal antibody (15952-1-AP)

MAT2B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15952-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase, Nbla02999, MSTP045, MATIIbeta, MAT II beta

• 

  WB analysis of HepG2 using 15952-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15952-1-AP (MAT2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15952-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15952-1-AP (MAT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15952-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15952-1-AP (MAT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 15952-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15952-1-AP (MAT2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15952-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15952-1-AP (MAT2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 15952-1-AP

  IP result of anti-MAT2B (IP:15952-1-AP, 4ug; Detection:15952-1-AP 1:500) with HepG2 cells lysate 1000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 15952-1-AP (MAT2B antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 15952-1-AP (MAT2B antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15952-1-AP (MAT2B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15952-1-AP (MAT2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15952-1-AP (MAT2B antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15952-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15952-1-AP (MAT2B antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15952-1-AP

  Immunofluorescent analysis of HepG2 cells, using MAT2B antibody 15952-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15952-1-AP

  Immunofluorescent analysis of HepG2 cells, using MAT2B antibody 15952-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAT2B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, mouse testis tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human lung tissue, mouse lung tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15952-1-AP targets MAT2B in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8649

  Product name: Recombinant human MAT2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-323 aa of BC005218

  Sequence: MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

• Full Name: methionine adenosyltransferase II, beta
• Calculated Molecular Weight: 36 kDa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005218
• Gene Symbol: MAT2B
• Gene ID (NCBI): 27430
• RRID: AB_10637268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZL9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

MAT2B Rabbit Polyclonal Antibody (Cat# 15952-1-AP) has 30 total citations published in journals including Molecular Cell, Cell Reports, Cell Death & Differentiation, Advanced Science, Pharmacological Research, Poultry Science, Journal of Agricultural and Food Chemistry, Scientific Reports, and Nutrients. Research fields covered include one-carbon metabolism, S-adenosylmethionine (SAM) synthesis, m6A RNA modification, epigenetics and DNA methylation, lipid metabolism, cancer biology, mitochondrial dysfunction, viral replication, traumatic brain injury, and nutritional epigenetics.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis.; Authors - Elodie Villa
human, mouse	WB,IP,CoIP	Adv Sci (Weinh); Activation of USP30 Disrupts Endothelial Cell Function and Aggravates Acute Lung Injury Through Regulating the S-Adenosylmethionine Cycle.; Authors - Baoyinna Baoyinna
human	WB	Cell Death Differ; A novel role of exostosin glycosyltransferase 2 (EXT2) in glioblastoma cell metabolism, radiosensitivity and ferroptosis; Authors - Rocío Matesanz-Sánchez
human	WB	Pharmacol Res; Developing patient-derived organoids to identify JX24120 inhibit SAMe synthesis in endometrial cancer by targeting MAT2B; Authors - Chunxue Zhang
pig	WB	J Anim Sci Biotechnol; Betaine alleviates hepatic lipid metabolism disorder in finishing pigs fed a low-energy diet through regulating m(6)A RNA methylation.; Authors - Chan Liang
mouse	WB	Cell Rep; Mutant CHCHD10 causes an extensive metabolic rewiring that precedes OXPHOS dysfunction in a murine model of mitochondrial cardiomyopathy.; Authors - Nicole M Sayles