MATN1 Recombinant monoclonal antibody, PBS Only (Detector)

MATN1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84313-1-PBS
Clone No.241643D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

241643D1, Cartilage matrix protein, CMP, CRTM, Matrilin 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84313-1-PBS targets MATN1 as part of a matched antibody pair:

MP01215-1: 84313-2-PBS capture and 84313-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29386

Product name: Recombinant human MATN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-280 aa of NM_002379

Sequence: SVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLI

Predict reactive species
Full Name matrilin 1, cartilage matrix protein
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberNM_002379
Gene Symbol MATN1
Gene ID (NCBI) 4146
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21941
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MATN1 (matrilin 1), also known as CMP. It is expected to be located in extracellular space, the protein is mainly expressed in cartilage tissue and retina tissue. Also, the protein is a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene have been associated with variety of inherited chondrodysplasias. It is reproted that COMP and matrilin-1 elute together in the gel filtration of cartilage extracts and can be co-immunoprecipitated with the presence of calcium (PMID: 15075323). The calculated molecular weight of MATN1 is 54 kDa.

Loading...
||
New chat Able
正在加载,请稍候...