MAZ Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of human prostate cancer using 82852-3-RR (same clone as 82852-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82852-3-RR (MAZ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82852-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 82852-3-RR (same clone as 82852-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82852-3-RR (MAZ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82852-3-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 82852-3-RR (same clone as 82852-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MAZ antibody (82852-3-RR, Clone: 1D5 ) at dilution of 1:950 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004). This data was developed using the same antibody clone with 82852-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82852-3-RR (same clone as 82852-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MAZ antibody (82852-3-RR, Clone: 1D5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82852-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82852-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82852-3-RR against Human MAZ were performed. The affinity constant is below 1 pM.

MAZ Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 82852-3-PBS

Clone No.1D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

1D5, MAZI, Myc-associated zinc finger protein, Pur 1, PUR1

---

Product Information

82852-3-PBS targets MAZ in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15200

  Product name: Recombinant human MAZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC041629

  Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG

• Full Name: MYC-associated zinc finger protein (purine-binding transcription factor)
• Calculated Molecular Weight: 477 aa, 49 kDa
• Observed Molecular Weight: 49-51 kDa
• GenBank Accession Number: BC041629
• Gene Symbol: MAZ
• Gene ID (NCBI): 4150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56270
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myc-associated zinc-finger protein (MAZ) is a transcription factor with dual roles in transcription initiation and termination. MAZ can activate the expression of a variety of genes such as the c-Myc, insulin, VEGF, and RAS gene family and the serotonin 1A receptor. MAZ plays a critical role in the progression of various cancers including breast, prostate, liver, and so on. Deregulation of MAZ expression is associated with the progression of pancreatic ductal adenocarcinoma (PDAC)(PMID: 29414775).