MAZ Recombinant monoclonal antibody

• 

  IHC staining of human prostate cancer using 82852-3-RR

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82852-3-RR (MAZ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 82852-3-RR

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82852-3-RR (MAZ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 82852-3-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MAZ antibody (82852-3-RR, Clone: 1D5 ) at dilution of 1:950 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004).

• 

  IF Staining of HeLa using 82852-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MAZ antibody (82852-3-RR, Clone: 1D5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 82852-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82852-3-RR against Human MAZ were performed. The affinity constant is below 1 pM.

MAZ Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 82852-3-RR

Clone No.1D5

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

1D5, MAZI, Myc-associated zinc finger protein, Pur 1, PUR1

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

82852-3-RR targets MAZ in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15200

  Product name: Recombinant human MAZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC041629

  Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG

• Full Name: MYC-associated zinc finger protein (purine-binding transcription factor)
• Calculated Molecular Weight: 477 aa, 49 kDa
• Observed Molecular Weight: 49-51 kDa
• GenBank Accession Number: BC041629
• Gene Symbol: MAZ
• Gene ID (NCBI): 4150
• RRID: AB_3086554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56270
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myc-associated zinc-finger protein (MAZ) is a transcription factor with dual roles in transcription initiation and termination. MAZ can activate the expression of a variety of genes such as the c-Myc, insulin, VEGF, and RAS gene family and the serotonin 1A receptor. MAZ plays a critical role in the progression of various cancers including breast, prostate, liver, and so on. Deregulation of MAZ expression is associated with the progression of pancreatic ductal adenocarcinoma (PDAC)(PMID: 29414775).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Commun Biol; Molecular mechanisms of MAZ targeting up-regulation of NDUFS3 expression to promote malignant progression in melanoma; Authors - Yu Feng