MBD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MBD1 Polyclonal antibody, PBS Only (29998-1-PBS)

• 

  WB analysis using 29998-1-AP (same clone as 29998-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29998-1-AP (MBD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29998-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29998-1-AP (same clone as 29998-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MBD1 antibody (29998-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 29998-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 29998-1-AP (same clone as 29998-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MBD1 antibody (29998-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 29998-1-PBS in a different storage buffer formulation.

MBD1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 29998-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

MBD 1

---

Product Information

29998-1-PBS targets MBD1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31424

  Product name: Recombinant human MBD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 393-605 aa of NM_015846

  Sequence: SEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ

• Full Name: methyl-CpG binding domain protein 1
• Calculated Molecular Weight: 67KD
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_015846
• Gene Symbol: MBD1
• Gene ID (NCBI): 4152
• RRID: AB_2935497
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIS9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MBD1, also known as RFT, PCM1, CXXC3, is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). MBD1 is a transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. MBD1 acts as a transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. Isoform 1 and isoform 2 can repress transcription from unmethylated promoters (PMID: 12665582, 14610093, 16757475).