MBD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MBD5 Polyclonal antibody, PBS Only (15961-1-PBS)

• 

  WB analysis of mouse heart using 15961-1-AP (same clone as 15961-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15961-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 15961-1-AP (same clone as 15961-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15961-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15961-1-AP (same clone as 15961-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15961-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MBD5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15961-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15961-1-PBS targets MBD5 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8728

  Product name: Recombinant human MBD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC014534

  Sequence: MPLNQILNQHNAASFPASSLLSAAAKAQLANQNKLAGNNSSSSSNSGAVAGSGNTEGHSTLNTMFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY

• Full Name: methyl-CpG binding domain protein 5
• Calculated Molecular Weight: 292 aa, 31 kDa, 160 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC014534
• Gene Symbol: MBD5
• Gene ID (NCBI): 55777
• RRID: AB_2281588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P267
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

In vertebrates, cytosine methylation in DNA is one of the major epigenetic modifications, which regulates many cellular events, including developmental gene expression, X chromosome inactivation, genome defense, and genomic imprinting. DNA methylation exerts regulatory functions by recruiting specific binding proteins that contain a highly conserved methyl-CpG binding domain (MBD) [PMID:12610534,16403636]. Methyl-CpG binding domain protein 5 (MBD5) belongs to the MBD family proteins, which play central roles in transcriptional regulation and development. It is a candidate gene involved in human 2q23.1 microdeletion syndrome [PMID:23077600].