MBOAT4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MBOAT4 Polyclonal antibody, PBS Only (32120-1-PBS)

• 

  WB analysis using 32120-1-AP (same clone as 32120-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32120-1-AP (MBOAT4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32120-1-PBS in a different storage buffer formulation.

MBOAT4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32120-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

OACT4, Membrane-bound O-acyltransferase domain-containing protein 4, GOAT, Ghrelin O-acyltransferase, FKSG89

---

Product Information

32120-1-PBS targets MBOAT4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37237

  Product name: Recombinant human MBOAT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-324 aa of NM_001100916

  Sequence: DDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRA

• Full Name: membrane bound O-acyltransferase domain containing 4
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_001100916
• Gene Symbol: MBOAT4
• Gene ID (NCBI): 619373
• RRID: AB_3670198
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96T53
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MBOAT4, also known as ghrelin O-acyltransferase (GOAT), is an endoplasmic reticulum enzyme that catalyzes the octanoylation of the peptide hormone ghrelin, which is essential for the binding of ghrelin to its receptor and the subsequent regulation of food intake, growth hormone secretion, and inhibition of insulin secretion (PMID: 34946685). MBOAT4 is considered a potential therapeutic target for treating disorders related to ghrelin signaling (PMID: 32564644).