MCEE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MCEE Polyclonal antibody (16499-1-AP)

MCEE Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16499-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

methylmalonyl CoA epimerase, MCE, GLOD2, EC:5.1.99.1, DL-methylmalonyl-CoA racemase

• 

  WB analysis using 16499-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16499-1-AP (MCEE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 16499-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16499-1-AP (MCEE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 16499-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16499-1-AP (MCEE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 16499-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16499-1-AP (MCEE antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 16499-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 16499-1-AP (MCEE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MCEE in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human heart tissue, human liver tissue, rat liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16499-1-AP targets MCEE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9665

  Product name: Recombinant human MCEE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC020825

  Sequence: MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA

• Full Name: methylmalonyl CoA epimerase
• Calculated Molecular Weight: 176 aa, 19 kDa
• Observed Molecular Weight: 15-19 kDa
• GenBank Accession Number: BC020825
• Gene Symbol: MCEE
• Gene ID (NCBI): 84693
• RRID: AB_2143812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PE7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MCEE polyclonal antibody (Cat# 16499-1-AP) has 2 citations. One appeared in Nature Metabolism (2022), studying altered propionate metabolism in tumour progression and aggressiveness. The other was published in BBA Molecular Basis of Disease (2023), investigating ACSS3's role in epithelial cell metabolic homeostasis and pulmonary fibrosis. Both citations used the antibody for Western blot in human samples, spanning research fields of cancer metabolism and lung disease.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Metab; Altered propionate metabolism contributes to tumour progression and aggressiveness.; Authors - Ana P Gomes
human	WB	Biochim Biophys Acta Mol Basis Dis; ACSS3 regulates the metabolic homeostasis of epithelial cells and alleviates pulmonary fibrosis; Authors - Lan Wang