MCEE Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85948-1-RR (same clone as 85948-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85948-1-RR (MCEE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85948-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 85948-1-RR (same clone as 85948-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 85948-1-RR (MCEE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85948-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85948-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85948-1-RR against Human MCEE were performed. The affinity constant is 0.126 nM.

MCEE Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85948-1-PBS

Clone No.250393G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DL methylmalonyl CoA racemase, DL-methylmalonyl-CoA racemase, EC:5.1.99.1, GLOD2, MCE

---

Product Information

85948-1-PBS targets MCEE in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9665

  Product name: Recombinant human MCEE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC020825

  Sequence: MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA

• Full Name: methylmalonyl CoA epimerase
• Calculated Molecular Weight: 176 aa, 19 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC020825
• Gene Symbol: MCEE
• Gene ID (NCBI): 84693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PE7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.