MCF2L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MCF2L Polyclonal antibody (27110-1-AP)

• 

  WB analysis using 27110-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27110-1-AP (MCF2L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

MCF2L Polyclonal Antibody for WB, ELISA

Cat No. 27110-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DBL's big sister, MCF2-transforming sequence-like protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27110-1-AP targets MCF2L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25906

  Product name: Recombinant human MCF2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-591 aa of BC020208

  Sequence: FREVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGE

• Full Name: MCF.2 cell line derived transforming sequence-like
• Calculated Molecular Weight: 984aa,112 kDa; 1108aa,124 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC020208
• Gene Symbol: MCF2L
• Gene ID (NCBI): 23263
• RRID: AB_3742215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15068
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCF2L, also known as DBS or ARHGEF14, encodes a guanine nucleotide exchange factor that specifically interacts with GTP-bound Rac1 and modulates Rho/Rac signaling cascades. This protein regulates cytoskeletal dynamics and cell migration, with emerging evidence linking its dysregulation to cancer progression.MCF2L has been identified as a genetic locus associated with osteoarthritis (PMID: 25483302).