MCL1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66026-1-Ig (same clone as 66026-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66026-1-Ig (same clone as 66026-1-PBS)

  WB result of MCL1 antibody (66026-1-Ig, 1:1000) with si-Control and si-MCL1 transfected Jurkat cells. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66026-1-Ig (same clone as 66026-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66026-1-Ig (same clone as 66026-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66026-1-Ig (same clone as 66026-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66026-1-Ig (same clone as 66026-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66026-1-Ig (same clone as 66026-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66026-1-Ig (same clone as 66026-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66026-1-Ig (same clone as 66026-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66026-1-Ig (MCL1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66026-1-Ig (same clone as 66026-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66026-1-Ig (MCL1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66026-1-Ig (same clone as 66026-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MCL1 antibody (66026-1-Ig, Clone: 1E3C2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66026-1-Ig (same clone as 66026-1-PBS)

  Immunofluorescent analysis of Hela cells, using MCL1 antibody 66026-1-lg at 1:25 dilution and Rhodamine-labeled goat anti-mouse IgG (red). This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66026-1-Ig (same clone as 66026-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 66026-1-Ig (MCL1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66026-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50655-1

  Cytometric bead array standard curve of MP50655-1, MCL1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66026-1-PBS. Detection antibody: 66026-2-PBS. Standard:Ag10609. Range: 0.098-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 66026-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 66026-1-Ig against Human MCL1 was performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

MCL1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 66026-1-PBS

Clone No.1E3C2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

1E3C2, Bcl2-L-3, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT

---

Product Information

66026-1-PBS targets MCL1 as part of a matched antibody pair:

MP50655-1: 66026-1-PBS capture and 66026-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10609

  Product name: Recombinant human MCL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-327 aa of BC107735

  Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

• Full Name: myeloid cell leukemia sequence 1 (BCL2-related)
• Calculated Molecular Weight: 350 aa, 37 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC107735
• Gene Symbol: MCL1
• Gene ID (NCBI): 4170
• RRID: AB_11041711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07820
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target.