MCL1 Recombinant monoclonal antibody

MCL1 Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 82695-4-RR
Clone No.5P13

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Induced myeloid leukemia cell differentiation protein Mcl-1, EAT, Bcl-2-related protein EAT/mcl1, Bcl-2-like protein 3, Bcl2-L-3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, MDA-MB-231 cells, Jurkat cells, Raji cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue, human ovarian cancer
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82695-4-RR targets MCL1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10397

Product name: Recombinant human MCL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-327 aa of BC107735

Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

Predict reactive species
Full Name myeloid cell leukemia sequence 1 (BCL2-related)
Calculated Molecular Weight 350 aa, 37 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC107735
Gene Symbol MCL1
Gene ID (NCBI) 4170
RRIDAB_3086509
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07820
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumor malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)

Protocols

Product Specific Protocols
WB protocol for MCL1 antibody 82695-4-RRDownload protocol
IHC protocol for MCL1 antibody 82695-4-RRDownload protocol
IF protocol for MCL1 antibody 82695-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...